Sermorelin/ Sermorelin Acetate/ GRF (1-29) amide (human) CAS 86168-78-7

Sermorelin/ Sermorelin Acetate/ GRF (1-29) amide (human) CAS 86168-78-7

Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.93
EINECS: 1312995-182-4
Product Categories: Peptide;Amino Acid Derivatives;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors;Sermorelin
Mol File: 86168-78-7.mol

Serm’orelin acetate is a biological active analog of growth releasing factor (GRF 1-44) which is a releasing hormone (GHRH) that is naturally produced by the human brain to stimulate production and secretion of by the pituitary gland. Serm’orelin is not a e; it is a secretagogue, which means that it stimulates the pituitary gland by binding to specific receptors to increase the production and secretion of

While aging, GHRH declines causing reduced production and secretion of pituitary and thereby increasing growth-hormone insufficiencies that erode health, stamina and vitality during later life. Serm’orelin is considered an anti-aging supplement that can assist the body in repairing damaged cells and weakened systems cause by insufficient .

Serm’orelin is a GHRH peptide analogue. Its peptide sequence is comprised of 29 amino acids. This sequence is a portion of the endogenous person GHRH, and is currently considered to be the shortest synthetic peptide that possesses the full array of functional GHRH activity. Due to this fact, sermor’elin is considered to be secretagogue.

Serm’orelin has been used during research to stimulate the secretion from the adenohypophysis (also called the anterior pituitary). The anterior pituitary secretes trophic . Serm’orelin has also been used in research stimulation tests to assess for pituitary sufficiency in relation to the secretion .

Sermorelin/ Sermorelin Acetate/ GRF (1-29) amide (human) CAS 86168-78-7 Chemical Properties
alpha D20 -63.1° (c = 1 in 30% acetic acid)
density 1.45±0.1 g/cm3(Predicted)
storage temp. −20°C
InChIKey BVLCEKWPOSAKSZ-YQMCHIOTSA-N
CAS DataBase Reference 86168-78-7(CAS DataBase Reference)

Functions of Sermorelin/ Sermorelin Acetate/ GRF (1-29) amide (human) CAS 86168-78-7
1. Increases energy, vitality, strength and endurance.
2. Growth of lean muscle mass/reduction of fat, Increase in lean muscle mass.
3. Breaks down body fat and fatty acids.
4. Improves heart function.
5. Increases calcium retention which strengthens and increases bone density.
6. Enhances the immune system and accelerates healing from wounds or surgery.
7. Promotes non-REM slow wave sleep, improved quality of sleep.
8. Increases protein synthesis and stimulates the growth of all internal organs except the brain.
9. Skin and nail health (tighter skin, thicker nails).
10. Decrease in body aches such as joint and muscle pain.

Applications of Sermorelin/ Sermorelin Acetate/ GRF (1-29) amide (human) CAS 86168-78-7
Serm’orelin has a wide range of positive effects. Due to its nature as a GHRH, sermo’relin only increases the body’s ability to produce more ; it is not an injection of itself. In both a performance enhancing and general well-being sense, sermo’relin has a wide array of benefits that make it a powerful and valuable substance.

Sermo’relin acetate is a human hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children.